AV39137

Anti-TSC22D2 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-TSC22 domain family, member 2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 79 kDa
• Reattività contro le specie: guinea pig, human, mouse, dog, rat, rabbit, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_055594
• N° accesso UniProt: O75157
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... TSC22D2(9819)

Descrizione

Immunogeno

Synthetic peptide directed towards the N terminal region of human TSC22D2

Azioni biochim/fisiol

Transforming growth factor (TGF)-β-stimulated clone 22 domain family of leucine zippers is involved in cellular osmotic stress response. TSC22D isoforms are regulated by glucocorticoids and TGF-β and aid the renal cells to adapt to hypertonicity.

Sequenza

Synthetic peptide located within the following region: CFQITSVTTAQVATSITEDTESLDDPDESRTEDVSSEIFDVSRATDYGPE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable