AV38386

Anti-NR5A2 antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-B1F, Anti-B1F2, Anti-CPF, Anti-FTF, Anti-FTZ-F1, Anti-FTZ-F1beta, Anti-LRH-1, Anti-Nuclear receptor subfamily 5, group A, member 2
• Numero MDL: MFCD07370495
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 61 kDa
• Reattività contro le specie: human, sheep, bovine
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_003813
• N° accesso UniProt: O00482
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NR5A2(2494)

Descrizione

Descrizione generale

Nuclear receptor subfamily 5, group A, member 2 (NR5A2, BIF2, FTZ-F1β) is a transcription factor involved in cholesterol transport, bile acid homeostasis and steroidogenesis. Also known as liver receptor homolog-1, LRH-1 is expressed primarily in liver, intestine, exocrine pancreas, ovary and embryonic stem cells (ESC). LRH-1 regulates the expression of the key bile acid biosynthetic enzyme cholesterol 7α hydroxylase (Cyp7A1).

Specificità

Anti-NR5A2 polyclonal antibody reacts with human and bovine nuclear receptor subfamily 5, group A, member 2/ liver receptor homolog-1 proteins.

Immunogeno

Synthetic peptide directed towards the N terminal region of human NR5A2

Applicazioni

Anti-NR5A2 polyclonal antibody is used to tag liver receptor homolog-1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of liver receptor homolog-1 in the regulation of bile acid biosynthesis, cholesterol transport and steroidogenesis.

Azioni biochim/fisiol

NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.

Sequenza

Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 1
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable