AV32524

Anti-NR5A2 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-B1F, Anti-B1F2, Anti-CPF, Anti-FTF, Anti-FTZ-F1, Anti-FTZ-F1beta, Anti-LRH-1, Anti-Nuclear receptor subfamily 5, group A, member 2
• Numero MDL: MFCD07370495
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 36 kDa
• Reattività contro le specie: guinea pig, rat, human
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_003813
• N° accesso UniProt: O60587
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... NR5A2(2494)

Descrizione

Descrizione generale

NR5A2 belongs to the nuclear receptor subfamily. It has been implicated in acinar cell differentiation and pancreatic carcinogenesis.
Rabbit Anti-NR5A2 (AB2) antibody recognizes chicken, human, mouse, and rat NR5A2.

Immunogeno

Synthetic peptide directed towards the middle region of human NR5A2

Applicazioni

Rabbit Anti-NR5A2 (AB2) antibody can be used for western blot applications at a concentration of 1μg/ml.

Azioni biochim/fisiol

NR5A2 binds to the sequence element 5′-AACGACCGACCTTGAG-3′ of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.

Sequenza

Synthetic peptide located within the following region: LPPTDYDRSPFVTSPISMTMLHGSLQGYQTYGHFPSRAIKSEYPDPYTSS

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable