AV35461

Anti-KCNAB2 (AB2) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Potassium voltage-gated channel, shaker-related subfamily, β member 2
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 39 kDa
• Reattività contro le specie: guinea pig, rabbit, dog, rat, human, bovine, mouse, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_742128
• N° accesso UniProt: Q13303-2
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... KCNAB2(8514)

Descrizione

Immunogeno

Synthetic peptide directed towards the C terminal region of human KCNAB2

Azioni biochim/fisiol

This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. This member alters functional properties of the KCNA4 gene product.

Sequenza

Synthetic peptide located within the following region: KYDSGIPPYSRASLKGYQWLKDKILSEEGRRQQAKLKELQAIAERLGCTL

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable