AV33617
Anti-CLDN9 antibody produced in rabbit
IgG fraction of antiserum
Sinonimo/i:
Anti-Claudin 9
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Prodotti consigliati
Origine biologica
rabbit
Livello qualitativo
Coniugato
unconjugated
Forma dell’anticorpo
IgG fraction of antiserum
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Forma fisica
buffered aqueous solution
PM
24 kDa
Reattività contro le specie
mouse, horse, bovine, rat, guinea pig, human, dog
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... CLDN9(9080)
Descrizione generale
Claudin-9, CLDN9, is a component of tight junction strands. CLDN9 is important for maintenance of sensory cells in the hearing organs. Mutations in the gene are associated with deafness.
Immunogeno
Synthetic peptide directed towards the C terminal region of human CLDN9
Azioni biochim/fisiol
CLDN9 is a member of claudin family. It is a four-transmembrane protein with WWCC motif, defined by W-X(17-22)-W-X(2)-C-X(8-10)-C.
Sequenza
Synthetic peptide located within the following region: WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
10 - Combustible liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Certificati d'analisi (COA)
Cerca il Certificati d'analisi (COA) digitando il numero di lotto/batch corrispondente. I numeri di lotto o di batch sono stampati sull'etichetta dei prodotti dopo la parola ‘Lotto’ o ‘Batch’.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Xiaowei Zhang et al.
Diagnostic pathology, 13(1), 11-11 (2018-02-07)
Several studies have suggested that claudin proteins, which are the main components of tight junction structures, are related to the regulation of cell polarity and cell differentiation. To explore the expression profiles of the tight junction proteins claudin-2, - 5, - 8
Yoko Nakano et al.
PLoS genetics, 5(8), e1000610-e1000610 (2009-08-22)
Hereditary hearing loss is one of the most common birth defects, yet the majority of genes required for audition is thought to remain unidentified. Ethylnitrosourea (ENU)-mutagenesis has been a valuable approach for generating new animal models of deafness and discovering
Katharina Reinhard et al.
Science (New York, N.Y.), 367(6476), 446-453 (2020-01-04)
Chimeric antigen receptor (CAR)-T cells have shown efficacy in patients with B cell malignancies. Yet, their application for solid tumors has challenges that include limited cancer-specific targets and nonpersistence of adoptively transferred CAR-T cells. Here, we introduce the developmentally regulated
Hongyu Liu et al.
The Turkish journal of gastroenterology : the official journal of Turkish Society of Gastroenterology, 30(8), 722-731 (2019-08-17)
We have previously identified a tight junction protein claudin-9 (CLDN9) as an upregulated gene in hepatocellular carcinoma (HCC) through an immunohistochemistry analysis. Here, we explore its function and clinical relevance in human HCC. Stable transfection of the hepatocyte line HL7702
Christian O Chavarría-Velázquez et al.
Immunobiology, 223(1), 38-48 (2017-10-17)
Gastric carcinogenesis has been associated to H. pylori virulence factors that induce a chronic inflammation process. Lipopolysaccharides play a role in chronic inflammatory responses via TLR2- and TLR4-dependent signaling pathways. Similarly, cellular invasiveness, metastatic potential and prognosis are usually associated
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.