AV31860

Anti-MyCBP antibody produced in rabbit

affinity isolated antibody

• Sinonimo/i: Anti-c-Myc binding protein
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: affinity isolated antibody
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 12 kDa
• Reattività contro le specie: guinea pig, human, rat
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: immunohistochemistry: suitable; western blot: suitable
• N° accesso NCBI: NP_036465
• N° accesso UniProt: Q99417
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... MYCBP(26292)

Descrizione

Descrizione generale

Rabbit polyclonal anti-MyCBP antibody reacts with human, mouse, rat, chicken, bovine, and canine c-Myc binding proteins.

c-Myc binding protein (MyCBP/AMY-1) binds the N-terminal region of myc and stimulates E box-dependent transcription of myc. MYCBP is up-regulated in colon carcinoma cells. MyCBP/AMY-1 is a trigger for erythrocyte differentiation. AMY-1 works as an inducer of human K562 cell differentiation upon induction of AraC.

Immunogeno

Synthetic peptide directed towards the middle region of human MYCBP

Applicazioni

Rabbit Anti-EHF antibody can be used for western blot applications at a dilution of 1.25μg/ml. The product can also be used for IHC assays at 4-8μg/ml, using paraffin-embedded tissues.

Rabbit polyclonal anti-MyCBP antibody is used to tag c-Myc binding protein for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of c-myc binding protein in the regulation of myc expression and erythrocyte differentiation.

Azioni biochim/fisiol

The MYCBP gene encodes a protein that binds to the N-terminal region of MYC and stimulates the activation of E box-dependent transcription by MYC.

Sequenza

Synthetic peptide located within the following region: AATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable