AV31691

Anti-FOXF1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinonimo/i: Anti-Forkhead box F1
• Codice UNSPSC: 12352203
• NACRES: NA.43

Proprietà

• Origine biologica: rabbit
• Livello qualitativo: 100
• Coniugato: unconjugated
• Forma dell’anticorpo: IgG fraction of antiserum
• Tipo di anticorpo: primary antibodies
• Clone: polyclonal
• Forma fisica: buffered aqueous solution
• PM: 38 kDa
• Reattività contro le specie: guinea pig, human, bovine, horse
• Concentrazione: 0.5 mg - 1 mg/mL
• tecniche: western blot: suitable
• N° accesso NCBI: NP_001442
• N° accesso UniProt: Q12946
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... FOXF1(2294)

Descrizione

Descrizione generale

FOXF1 is a transcription factor that is induced upon p53-dependent DNA damage. Studies have reported that this transcription factor may act as a p53 target. FOXF1 may also regulate the invasion and migration of cancer cells.
Rabbit Anti-FOXF1 recognizes human FOXF1.

Immunogeno

Synthetic peptide directed towards the N terminal region of human FOXF1

Applicazioni

Rabbit Anti-FOXF1 can be used for western blot applications at 1.25μg/ml.

Azioni biochim/fisiol

FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development.

Sequenza

Synthetic peptide located within the following region: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable