Passa al contenuto
Merck
Tutte le immagini(3)

Documenti fondamentali

AV100880

Sigma-Aldrich

Anti-EGR2 antibody produced in rabbit

affinity isolated antibody

Sinonimo/i:

Anti-CMT1D, Anti-CMT4E, Anti-DKFZp686J1957, Anti-Early growth response 2 (Krox-20 homolog, Drosophila), Anti-FLJ14547, Anti-KROX20

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
Tutte le immagini(3)

About This Item

Codice UNSPSC:
12352203
NACRES:
NA.41

Origine biologica

rabbit

Livello qualitativo

100

Coniugato

unconjugated

Forma dell’anticorpo

affinity isolated antibody

Tipo di anticorpo

primary antibodies

Clone

polyclonal

Stato

buffered aqueous solution

PM

50 kDa

Reattività contro le specie

mouse, bovine, human

Concentrazione

0.5 mg - 1 mg/mL

tecniche

immunohistochemistry: suitable
western blot: suitable

N° accesso NCBI

NP_000390

N° accesso UniProt

P11161

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

modifica post-traduzionali bersaglio

unmodified

Informazioni sul gene

human ... EGR2(1959)

Descrizione generale

Early growth response (EGR) proteins are transcriptional regulators (EGR1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 2 (EGR2, Krox20, CMT1D, CMT4E), a C2H2-type zinc-finger protein, regulates a wide spectrum of cellular responses including differentiation (osteoclast), tissue (brain) patterning, and apoptosis.

Specificità

Rabbit polyclonal anti-EGR2 antibody reacts with zebrafish, canine, human, mouse, rat, and pig early growth response 2 factors.

Immunogeno

Synthetic peptide directed towards the C terminal region of human EGR2

Applicazioni

Rabbit polyclonal anti-EGR2 antibody is used to tag early growth response 2 factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of early growth response 2 factor in cell processes such as differentiation (osteoclast), tissue (brain) patterning, and apoptosis. Anti-EGR2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Sequenza

Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG

Stato fisico

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Non trovi il prodotto giusto?  

Prova il nostro Motore di ricerca dei prodotti.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 3

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable

Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number
QC7884

Non trovi la versione di tuo interesse?

Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.

Cerca un COA

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Yankel Gabet et al.
Blood, 116(19), 3964-3971 (2010-08-19)
Krox20/EGR2, one of the 4 early growth response genes, is a highly conserved transcription factor implicated in hindbrain development, peripheral nerve myelination, tumor suppression, and monocyte/macrophage cell fate determination. Here, we established a novel role for Krox20 in postnatal skeletal
Charlotte Labalette et al.
Development (Cambridge, England), 138(2), 317-326 (2010-12-24)
Vertebrate hindbrain segmentation is an evolutionarily conserved process that involves a complex interplay of transcription factors and signalling pathways. Fibroblast growth factor (FGF) signalling plays a major role, notably by controlling the expression of the transcription factor Krox20 (Egr2), which
V P Sukhatme
Journal of the American Society of Nephrology : JASN, 1(6), 859-866 (1990-12-01)
How eucaryotic cells respond to growth signals is a topic of considerable interest. Though much attention has focused on second messenger pathways, in recent years, progress has been made on elucidating the transcriptional events that lie more distally in the
Hozo Matsuoka et al.
International journal of molecular sciences, 19(2) (2018-02-09)
Neurotropin® (NTP), a non-protein extract of inflamed rabbit skin inoculated with vaccinia virus, is clinically used for the treatment of neuropathic pain in Japan and China, although its effect on peripheral nerve regeneration remains to be elucidated. The purpose of

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.