AV48116

Anti-SLC14A1 antibody produced in rabbit

affinity isolated antibody

• Synonym(e): Anti-FLJ33745, Anti-FLJ41687, Anti-HUT11, Anti-HsT1341, Anti-JK, Anti-RACH1, Anti-Solute carrier family 14 (urea transporter), member 1 (Kidd blood group), Anti-UT-B1
• UNSPSC-Code: 12352203

Eigenschaften

• Biologische Quelle: rabbit
• Qualitätsniveau: 100
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Form: buffered aqueous solution
• Mol-Gew.: 42 kDa
• Speziesreaktivität: human
• Konzentration: 0.5 mg - 1 mg/mL
• Methode(n): immunohistochemistry: suitable; western blot: suitable
• NCBI-Hinterlegungsnummer: NP_001122060
• UniProt-Hinterlegungsnummer: Q13336
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... SLC14A1(6563)

Beschreibung

Allgemeine Beschreibung

SLC14A1 codes for a protein that belongs to the solute carrier family. It facilitates the transport of urea in red blood cells and also forms the basis of the Kidd blood grouping system. SLC14A1 has been identified as a susceptibility locus for bladder cancer.
Rabbit Anti-SLC14A1 antibody recognizes human, canine, bovine, and mouse SLC14A1.

Immunogen

Synthetic peptide directed towards the C terminal region of human SLC14A1

Anwendung

Rabbit Anti-SLC14A1 antibody is suitable for western blot applications at a concentration of western blot at a concentration of 0.25 μg/ml and for IHC at 4-8 μg/ml.

Biochem./physiol. Wirkung

SLC14A1 is a specialized low-affinity urea transporter. It mediates urea transport in erythrocytes.

Sequenz

Synthetic peptide located within the following region: LSSPLMCLHAAIGSLLGIAAGLSLSAPFENIYFGLWGFNSSLACIAMGGM

Physikalische Form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Haftungsausschluss

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 3
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable