WH0055294M2

Monoclonal Anti-FBXW7 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-AGO, Anti-CDC4, Anti-DKFZp686F23254, Anti-F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila), Anti-FBW7, Anti-FBX30, Anti-FBXW6, Anti-SEL10
• Número MDL: MFCD09265424
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3D1, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_033632
• nº de adesão UniProt: Q969H0
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... FBXW7(55294)

Descrição

Descrição geral

F-box and WD40 domain protein 7 (FBXW7) is a member of F-box protein family, which acts as a substrate recognition component of the ubiquitin ligase complex SCF (Skp-Cullin-F-box). The proteins have a bipartite structure. The shared F-box motif links F-box protein to Skp1 and the core complex, whereas divergent protein-protein interaction motifs selectively bind their cognate substrates. There are three FBXW7 isoforms α, β ,γ that share 10 out of 11 exons but they differ in their subcellular localization as well as in substrate recognition activity. The gene encoding FBXW7 is localized on human chromosome 4q31.3.

Imunogênio

FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Aplicação

Monoclonal Anti-FBXW7 antibody produced in mouse has been used in Western blotting and immunohistochemistry.

Ações bioquímicas/fisiológicas

F-box proteins are associated with various signaling pathways, such as nutrient sensing in yeast, conserved developmental pathways in plants and animals. These proteins mediate recognition of phosphorylated targets including Cyclin E, Myc, c-Jun, and Notch, leading to their ubiquitination and degradation. Similar to the inactivation mode of other known tumor suppressors, the SV40 large T antigen binds F-box and WD40 domain protein 7 (FBXW7) without detectible effects on its stability, and thus acts as an inhibitor of FBXW7 activity.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)