WH0054345M1

Monoclonal Anti-SOX18 antibody produced in mouse

clone 2G12, ascites fluid

• Sinônimo(s): Anti-HLTS, Anti-SRY (sex determining region Y)-box 18
• Número MDL: MFCD07370511
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: ascites fluid
• tipo de produto de anticorpo: primary antibodies
• clone: 2G12, monoclonal
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_018419
• nº de adesão UniProt: P35713
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SOX18(54345)

Descrição

Descrição geral

This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This protein plays a role in hair, blood vessel, and lymphatic vessel development. Mutations in this gene have been associated with recessive and dominant forms of hypotrichosis-lymphedema-telangiectasia. (provided by RefSeq)

Imunogênio

SOX18 (NP_060889, 63 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EPGRYGLSPAGRGERQAADESRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNAAEKRPFVEEAERLRVQHLRDHP

forma física

Solution

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)