WH0023462M1

Monoclonal Anti-HEY1 antibody produced in mouse

clone 3B3, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-CHF2, Anti-HERP2, Anti-HESR1, Anti-HRT1, Anti-hairy/enhancer-of-split related with YRPW motif 1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3B3, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão GenBank: NM_012258
• nº de adesão UniProt: Q9Y5J3
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... HEY1(23462)

Descrição

Descrição geral

Hey1/HESR1 (hes related family bHLH transcription factor with YRPW motif 1) is a basic helix-loop-helix transcription factor that belongs to the HES family. It is located on human chromosome 8q21.

This gene encodes a nuclear protein belonging to the hairy and enhancer of split-related (HESR) family of basic helix-loop-helix (bHLH)-type transcriptional repressors. Expression of this gene is induced by the Notch and c-Jun signal transduction pathways. Two similar and redundant genes in mouse are required for embryonic cardiovascular development, and are also implicated in neurogenesis and somitogenesis. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Imunogênio

HEY1 (NP_036390, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLG

Ações bioquímicas/fisiológicas

Hey1/HESR1 (hes related family bHLH transcription factor with YRPW motif 1) participates in the progression of brain tumors. HESR1 is required for the initiation of a tubular network and to maintain mature and quiescent blood vessels. Overexpression of Hey1 results in osteopenia and chondrocyte hypertrophy in bone.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)