WH0004586M7
Monoclonal Anti-MUC5AC antibody produced in mouse
clone 2H7, purified immunoglobulin, buffered aqueous solution
Sinônimo(s):
Anti-MUC5, Anti-mucin 5, subtypes A and C, tracheobronchial/gastric
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
fonte biológica
mouse
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
purified immunoglobulin
tipo de produto de anticorpo
primary antibodies
clone
2H7, monoclonal
forma
buffered aqueous solution
reatividade de espécies
human
técnica(s)
indirect ELISA: suitable
western blot: 1-5 μg/mL
Isotipo
IgG1κ
nº de adesão GenBank
nº de adesão UniProt
Condições de expedição
dry ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... MUC5AC(4586)
Descrição geral
Mucin 5AC (MUC5AC) is encoded by the gene mapped to human chromosome 11p15.5 and is predominantly expressed in the gastric and tracheobronchial mucosae. The MUC5AC protein contains two types of deduced peptide domains such as eight amino acid tandemly repeated (TR) domains and cysteine-rich domains.
Imunogênio
MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Sequence
NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH
Ações bioquímicas/fisiológicas
Increased expression of Mucin 5AC (MUC5AC) leads to epithelial cancer progression, including colon cancer. Therefore, MUC5AC is considered to be a potential target in the treatment of colon cancer. MUC5AC containing the carbohydrate blood-group antigen, Lewis B (LeB) functions as a key receptor for Helicobacter pylori. O-glycoprotein encoded by the gene plays a vital role in mucus formation and epithelium protection. Decreased level of MUC5AC expression in ocular surface might lead to the tear instability in patients with SjÖgren syndrome.
forma física
Solution in phosphate buffered saline, pH 7.4
Informações legais
GenBank is a registered trademark of United States Department of Health and Human Services
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Equipamento de proteção individual
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Pablo Argüeso et al.
Investigative ophthalmology & visual science, 43(4), 1004-1011 (2002-03-30)
To determine whether the relative amounts of mucin mRNA in the conjunctival epithelium and mucin protein in the tears are altered in patients with Sjögren syndrome compared with healthy individuals. Tear fluid was collected from the inferior fornix of normal
Michaël Perrais et al.
The Journal of biological chemistry, 277(35), 32258-32267 (2002-06-22)
The 11p15 mucin genes (MUC2, MUC5AC, MUC5B and MUC6) possess a cell-specific pattern of expression in normal lung that is altered during carcinogenesis. Growth factors of the epidermal growth factor family are known to target key genes that in turn
A E Biemer-Hüttmann et al.
The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society, 47(8), 1039-1048 (1999-07-29)
We studied the distribution of the four human apomucins MUC1, MUC2, MUC4, and MUC5AC in hyperplastic polyps, serrated adenomas, and traditional adenomas of the colorectum using immunohistochemical techniques, with the aim of comparing and contrasting their patterns of expression. A
Jeroen H B Van de Bovenkamp et al.
Helicobacter, 8(5), 521-532 (2003-10-11)
Helicobacter pylori shows a characteristic tropism for the mucus-producing gastric epithelium. In infected patients, H. pylori colocalizes in situ with the gastric secretory mucin MUC5AC. The carbohydrate blood-group antigen Lewis B (LeB) was deemed responsible for the adherence of H.
V Guyonnet Duperat et al.
The Biochemical journal, 305 ( Pt 1), 211-219 (1995-01-01)
To date five human mucin cDNAs (MUC2, 5A, 5B, 5C and 6) mapped to 11p15.3-15.5, so it appears that this chromosome region might contain several distinct gene loci for mucins. Three of these cDNAs, MUC5A, B and C, were cloned
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica