WH0002954M1

Monoclonal Anti-GSTZ1 antibody produced in mouse

clone 1G12, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-GSTZ11, Anti-MAAI, Anti-MAI, Anti-MGC2029, Anti-glutathione transferase zeta 1 (maleylacetoacetate isomerase)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1G12, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human, mouse, rat
• técnica(s): indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2bκ
• nº de adesão GenBank: NM_145870
• nº de adesão UniProt: O43708
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... GSTZ1(2954)

Descrição

Descrição geral

This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. (provided by RefSeq)

Imunogênio

GSTZ1 (NP_665877, 109 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)