WH0000999M1

Monoclonal Anti-CDH1 antibody produced in mouse

clone 3F4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): Anti-Arc1, Anti-CDHE, Anti-ECAD, Anti-LCAM, Anti-UVO, Anti-cadherin 1, type 1, E-cadherin (epithelial)
• Número MDL: MFCD00211889
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3F4, monoclonal
• forma: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão GenBank: NM_004360
• nº de adesão UniProt: P12830
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CDH1(999)

Descrição

Descrição geral

Cadherin 1 (CDH1), a transmembrane glycoprotein is present on the epithelial cell surface. It comprises a single transmembrane region, large extracellular domain, and a short cytoplasmic domain. The CDH1 gene is mapped to human chromosome 16q22.1. It is expressed in the embryonic stage especially during lip and palate development.

Imunogênio

CDH1 (NP_004351, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KGQVPENEANVVITTLKVTDADAPNTPAWEAVYTILNDDGGQFVVTTNPVNNDGILKTAKGLDFEAKQQYILHVAVTNVVPFEVSLTTSTATVTVDVLDV

Aplicação

Monoclonal Anti-CDH1 antibody produced in mouse has been used in immunohistochemistry and western blotting. 1:2000

Ações bioquímicas/fisiológicas

Cadherin 1 (CDH1) interacts with the actin cytoskeleton through its cytoplasmic domain. It plays a key role in epithelial cell-cell adhesion, maintaining tissue integrity, and migration of cells. CDH1 may also participate in the wingless (wnt) signal transduction pathway. Mutations in CDH1 are implicated in lobular breast cancer ovary cancer and blepharocheilodontic (BCD) syndrome characterized with cleft lip/palate, and ectodermal dysplasia.

forma física

Solution in phosphate buffered saline, pH 7.4

Informações legais

GenBank is a registered trademark of United States Department of Health and Human Services

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)