SAB5702269

Anti-CD68 Antibody, clone 5S2F7, Rabbit Monoclonal

• Sinônimo(s): CD68,GP110,LAMP4,SCARD1
• Código UNSPSC: 12352203

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 5S2F7, monoclonal
• forma: liquid
• peso molecular: 80-130 kDa
• reatividade de espécies: human, rat, rat
• concentração: 1 mg/mL
• técnica(s): flow cytometry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
• nº de adesão UniProt: P34810
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... CD68(968)

Descrição

Descrição geral

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB, FC

Informações de segurança

• Pictogramas: GHS07,GHS09
• Palavra indicadora: Warning
• Frases de perigo: H317 - H411
• Declarações de precaução: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classificações de perigo: Aquatic Chronic 2 - Skin Sens. 1
• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3