SAB5702155

Anti-NeuN Antibody, clone 3M5M9, Rabbit Monoclonal

• Sinônimo(s): FOX-3,FOX3,HRNBP3,NEUN,NeuN,RBFOX3
• Código UNSPSC: 12352203
• NACRES: NA.46
• clone: 3M5M9, monoclonal
• application: IF; IHC; WB
• reatividade de espécies: rat, rat, human
• técnica(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• Materiais: colorless
• clone: 3M5M9, monoclonal
• Formulário: liquid
• peso molecular: 46-55 kDa
• reatividade de espécies: rat, rat, human
• concentração: 1.00 mg/mL
• técnica(s): immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• cor: colorless
• Isotipo: IgG
• sequência de imunogênio: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR
• nº de adesão UniProt: A6NFN3
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... RBFOX3(146713)

Descrição

Descrição geral

This gene encodes a member of the RNA-binding FOX protein family which is involved in the regulation of alternative splicing of pre-mRNA. The protein has an N-terminal proline-rich region, an RNA recognition motif (RRM) domain, and a C-terminal alanine-rich region. This gene produces the neuronal nuclei (NeuN) antigen that has been widely used as a marker for post-mitotic neurons. This gene has its highest expression in the central nervous system and plays a prominent role in neural tissue development and regulation of adult brain function. Mutations in this gene have been associated with numerous neurological disorders. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.

Imunogênio

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NeuN (A6NFN3).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Aplicação

WB, IHC, IF/ICC

Informações de segurança

• Pictogramas: GHS07,GHS09
• Palavra indicadora: Warning
• Frases de perigo: H317,H411
• Declarações de precaução: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classificações de perigo: Aquatic Chronic 2 - Skin Sens. 1
• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3