SAB2109199

Anti-SEZ6 (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 105 kDa
• reatividade da espécie (prevista por homologia): human, bovine, mouse, rabbit, rat, canine, horse
• concentração: 0.5 mg/mL
• técnica(s): western blot: 1 μg/mL
• nº de adesão NCBI: NM_178860
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SEZ6(57396)

Descrição

Descrição geral

SEZ6 may play a role in cell-cell recognition and in neuronal membrane signaling. It seems to be important for the achievement of the necessary balance between dendrite elongation and branching during the elaboration of a complex dendritic arbor. SEZ6 is involved in the development of appropriate excitatory synaptic connectivity.

Imunogênio

Synthetic peptide directed towards the C-terminal region of Human SEZ6

Sequência

Synthetic peptide located within the following region: RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable