SAB2109161

Anti-MC2R (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): ACTHR, MGC125798
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 33 kDa
• reatividade da espécie (prevista por homologia): bovine, mouse, rat, rabbit, guinea pig, horse, human, canine
• concentração: 0.5 mg/mL
• técnica(s): western blot: 1 μg/mL
• nº de adesão NCBI: NM_000529
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MC2R(57396)

Descrição

Descrição geral

MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency.

Sequência

Synthetic peptide located within the following region: LRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHA

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 12 - Non Combustible Liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable