SAB2109130

Anti-ADORA2A (C-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): ADORA2, RDC8, hA2aR
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: IHC (p); WB
• clone: polyclonal
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL; western blot: 1 μg/mL

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 45 kDa
• reatividade da espécie (prevista por homologia): canine, mouse, rat, rabbit, bovine, human, horse, guinea pig
• concentração: 0.5 mg/mL
• técnica(s): immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL; western blot: 1 μg/mL
• nº de adesão NCBI: NM_000675
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ADORA2A(57396)

Descrição

Descrição geral

ADORA2A is one of several receptor subtypes for adenosine. The activity of the protein, a G-protein coupled receptor family member, is mediated by G proteins which activate adenylyl cyclase. ADORA2A is abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.

Imunogênio

Synthetic peptide directed towards the C terminal region of human ADORA2A

Sequência

Synthetic peptide located within the following region: MESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCP

forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): nwg
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable