SAB2104260

Anti-EBF2 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-COE2, Anti-EBF-2, Anti-FLJ11500, Anti-O/E-3, Anti-OE-3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 63 kDa
• reatividade de espécies: bovine, horse, human, rabbit, mouse, rat, guinea pig, dog
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NM_022659
• nº de adesão UniProt: Q9HAK2
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EBF2(64641)

Descrição

Imunogênio

Synthetic peptide directed towards the middle region of human EBF2

Ações bioquímicas/fisiológicas

EBF2 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors.EBF2 belongs to the conserved Olf/EBF family (see MIM 164343) of helix-loop-helix transcription factors (Wang et al., 2002 [PubMed 12139918]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-103 AU120738.1 302-404 104-650 AL701879.1 1-547 651-735 AC090103.4 79460-79544 736-796 BC069665.1 1-61 797-1794 BC074794.2 1-998 1795-2297 AK021562.1 1082-1584

Sequência

Synthetic peptide located within the following region: GDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRN

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable