Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

SAB2102096

Sigma-Aldrich

Anti-SCRT2 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-Scratch homolog 2, zinc finger protein (Drosophila)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

32 kDa

reatividade de espécies

yeast, human

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão UniProt

Q9NQ03

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

Informações sobre genes

human ... SCRT2(85508)

Categorias relacionadas

Imunogênio

Synthetic peptide directed towards the middle region of human SCRT2

Ações bioquímicas/fisiológicas

SCRT2 belongs to the snail C2H2-type zinc-finger protein family. It contains 5 C2H2-type zinc fingers. SCRT2 may be involved in transcriptional regulation.

Sequência

Synthetic peptide located within the following region: HMQTHSAFKHYRCRQCDKSFALKSYLHKHCEAACAKAAEPPPPTPAGPAS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Vanessa Paul et al.
Cerebral cortex (New York, N.Y. : 1991), 24(3), 754-772 (2012-11-28)
Scratch genes (Scrt) are neural-specific zinc-finger transcription factors (TFs) with an unknown function in the developing brain. Here, we show that, in addition to the reported expression of mammalian Scrt2 in postmitotic differentiating and mature neurons in the developing and
Thomas J Ha et al.
BMC genomics, 20(1), 718-718 (2019-09-20)
The work of the FANTOM5 Consortium has brought forth a new level of understanding of the regulation of gene transcription and the cellular processes involved in creating diversity of cell types. In this study, we extended the analysis of the

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica