Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

SAB1412433

Sigma-Aldrich

ANTI-MUC2 antibody produced in mouse

clone 1H2, purified immunoglobulin, buffered aqueous solution

Sinônimo(s):

MLP, MUC2, SMUC

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

mouse

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

purified immunoglobulin

tipo de produto de anticorpo

primary antibodies

clone

1H2, monoclonal

forma

buffered aqueous solution

peso molecular

antigen 36.63 kDa

reatividade de espécies

human

técnica(s)

indirect ELISA: suitable

Isotipo

IgG2bκ

nº de adesão NCBI

NM_002457

nº de adesão UniProt

Q02817

Condições de expedição

dry ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... MUC2(4583)

Descrição geral

This gene encodes a member of the mucin protein family. Mucins are high molecular weight glycoproteins produced by many epithelial tissues. The protein encoded by this gene is secreted and forms an insoluble mucous barrier that protects the gut lumen. The protein polymerizes into a gel of which 80% is composed of oligosaccharide side chains by weight. The protein features a central domain containing tandem repeats rich in threonine and proline that varies between 50 and 115 copies in different individuals. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. (provided by RefSeq)

Imunogênio

MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*

forma física

Solution in phosphate buffered saline, pH 7.4

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Tsukasa Nishida et al.
Diseases of the colon and rectum, 57(8), 905-915 (2014-07-09)
The appropriateness of endoscopic resection in patients with T1 colorectal carcinomas is unclear. Highly precise predictors of lymph node metastasis are required to optimize the outcomes of treatments for T1 colorectal carcinomas. The purpose of this work was to identify
Takanori Yamada et al.
Food and chemical toxicology : an international journal published for the British Industrial Biological Research Association, 70, 107-113 (2014-05-20)
Helicobacter pylori (H. pylori) infection is well known to be associated with chronic gastritis and also development of gastric cancer. Raphanobrassica (RB) is an intergeneric hybrid of the genera Raphanus (radish) and Brassica (cabbages) containing appreciable amounts of glucoraphanin (GR)
Øystein Sørdal et al.
Experimental and molecular pathology, 96(3), 274-278 (2014-03-05)
The purpose of this study is to assess the exocrine and neuroendocrine properties of tumour cells in diffuse gastric cancer with signet ring cell differentiation. Mucin mRNA and protein expressions (MUC1, 2, 3, 4, 5AC, 6 and MUC13) were assessed
Stéphanie Da Silva et al.
American journal of physiology. Gastrointestinal and liver physiology, 307(4), G420-G429 (2014-06-28)
Despite well-known intestinal epithelial barrier impairment and visceral hypersensitivity in irritable bowel syndrome (IBS) patients and IBS-like models, structural and physical changes in the mucus layer remain poorly understood. Using a water avoidance stress (WAS) model, we aimed at evaluating

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica