SAB1412393

ANTI-SREBF1 antibody produced in mouse

clone 4G4, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): SREBF1, SREBP-1c, SREBP1, bHLHd1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 4G4, monoclonal
• Formulário: buffered aqueous solution
• peso molecular: antigen 36.63 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG2aκ
• nº de adesão NCBI: BC057388
• nº de adesão UniProt: P36956
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SREBF1(6720)

Descrição

Descrição geral

Sterol regulatory element binding transcription factor 1 (SREBF1) gene is located on human chromosome 17p11.2. SREBF1 encodes the transcription factors SREBP-1a and SREBP-1c. SREBP-1a is expressed in spleen and intestine.SREBP-1c is expressed in liver, adipose tissue and skeletal muscle.

Imunogênio

SREBF1 (AAH57388, 801 a.a. ~ 900 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYLQLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL

Ações bioquímicas/fisiológicas

Sterol regulatory element binding transcription factor 1 (SREBF1) regulates lipogenesis, energy homeostasis and insulin sensitivity. It is associated with non-alcoholic fatty liver disease (NAFLD). SREBF1 promotes tumor growth in various cancers. SREBF1 acts as a molecular bridge between lipogenesis and cell cycle control clear cell renal carcinoma.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable