SAB1412165

ANTI-BTG2 antibody produced in mouse

clone 1B8, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): BTG2, MGC126063, MGC126064, PC3, TIS21
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• Nível de qualidade: 100
• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1B8, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen 36.74 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• Isotipo: IgG1κ
• nº de adesão NCBI: NM_006763
• nº de adesão UniProt: P78543
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... BTG2(7832)

Descrição

Descrição geral

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle. (provided by RefSeq)

Imunogênio

BTG2 (NP_006754, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable