SAB1404375

Monoclonal Anti-SLC3A1 antibody produced in mouse

clone 2F2, ascites fluid

• Sinônimo(s): ATR1, CSNU1, D2H, FLJ34681, NBAT, RBAT
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (i); WB
• clone: 2F2, monoclonal
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1:500-1:1000

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: ascites fluid
• tipo de produto de anticorpo: primary antibodies
• clone: 2F2, monoclonal
• peso molecular: antigen ~38.1 kDa
• reatividade de espécies: human
• técnica(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgG2aκ
• nº de adesão NCBI: BC022386
• nº de adesão UniProt: Q07837
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SLC3A1(6519)

Descrição

Descrição geral

This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract. Mutations and deletions in this gene are associated with cystinuria. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. (provided by RefSeq)

Imunogênio

SLC3A1 (AAH22386, 211 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL

forma física

Clear solution

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable