SAB1402390

Monoclonal Anti-VEGF antibody produced in mouse

clone 3F7, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): MGC70609, VEGF, VEGF-A, VPF
• Número MDL: MFCD00282511
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: mouse
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 3F7, monoclonal
• forma: buffered aqueous solution
• peso molecular: antigen ~37.55 kDa
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; indirect ELISA: suitable; proximity ligation assay: suitable; western blot: suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_003376
• nº de adesão UniProt: P15692
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... VEGFA(7422)

Descrição

Descrição geral

The vascular endothelial growth factor (VEGF) gene is localized on human chromosome 6p21.3 and is thought to encode four different isoforms. It signals through the three receptors, that is, fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product. The protein is expressed in vascularized tissues.

This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms. (provided by RefSeq)

Imunogênio

VEGF (NP_003367, 27 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC

Aplicação

Monoclonal Anti-VEGF antibody produced in mouse has been used in Western Blotting.

Ações bioquímicas/fisiológicas

Vascular endothelial growth factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates the proliferation and survival of endothelial cells. It promotes angiogenesis and vascular permeability. VEGF is involved in the induction of tumor metastasis and intraocular neovascular syndromes.Polymorphism in the gene encoding it is linked with diabetic retinopathy in type 2 diabetes.

forma física

Solution in phosphate buffered saline, pH 7.4

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable