SAB1401359

Monoclonal Anti-SEC13 antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

• Sinônimo(s): D3S1231E, SEC13L1, SEC13R, npp-20
• Código UNSPSC: 12352203
• NACRES: NA.41
• conjugado: unconjugated
• application: ELISA (c); IF; IP
• clone: 1G7, monoclonal
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunofluorescence: suitable; immunoprecipitation (IP): suitable

Propriedades

• fonte biológica: mouse
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: purified immunoglobulin
• tipo de produto de anticorpo: primary antibodies
• clone: 1G7, monoclonal
• Formulário: buffered aqueous solution
• reatividade de espécies: human
• técnica(s): capture ELISA: suitable; immunofluorescence: suitable; immunoprecipitation (IP): suitable
• Isotipo: IgG2aκ
• nº de adesão NCBI: NM_030673
• nº de adesão UniProt: P55735
• Condições de expedição: dry ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SEC13(6396)

Descrição

Descrição geral

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found. (provided by RefSeq)

Imunogênio

SEC13 (NP_109598, 226 a.a. ~ 324 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNE

forma física

Solution in phosphate buffered saline, pH 7.4

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable