MSST0062
SILu™Lite APOD, Apolipoprotein D human
recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)
Sinônimo(s):
Apo-D, ApoD
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
23201100
NACRES:
NA.24
Produtos recomendados
Descrição geral
SILu™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Ações bioquímicas/fisiológicas
Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.
Sequência
QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ
forma física
Supplied as a lyophilized powder containing phosphate buffered saline.
Informações legais
SILu is a trademark of Sigma-Aldrich Co. LLC
Código de classe de armazenamento
11 - Combustible Solids
Classe de risco de água (WGK)
WGK 2
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica