Pular para o conteúdo
Merck
Todas as fotos(7)

Documentos Principais

HPA055888

Sigma-Aldrich

Anti-FAM107A antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-DRR1, Anti-TU3A, Anti-family with sequence similarity 107, member A

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(7)

About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA055888
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnica(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

NQLIKKKKEELEAKRLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEER

nº de adesão UniProt

O95990

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... FAM107A(11170)

Descrição geral

FAM107A (family with sequence similarity 107 member A) is expressed at high level in the brain and heart. It is also known as DRR1, FLJ30158, FLJ45473, TU3A. FAM107A has a nuclear localization signal (NLS) and a coiled domain. FAM107A has 144 amino acids and is located on human chromosome 3p14.3.

Imunogênio

family with sequence similarity 107, member A recombinant protein epitope signature tag (PrEST)

Ações bioquímicas/fisiológicas

FAM107A (family with sequence similarity 107 member A) participates in neuronal cell survival. Overexpression of FAM107A has the ability to repress the development of tumor cells. It plays a major role in the progression of embryo. FAM107A participates in cell invasion. This protein modulates FA dynamics and cell movement.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST73998

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
R74514

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Fusion of regionally specified hPSC-derived organoids models human brain development and interneuron migration.
Xiang Y, et al.
Cell Stem Cell, 21(3), 383-398 (2017)
FAM107A (family with sequence similarity 107, member A).
Kadomatsu K and Mu P
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2011)
Xin Zhou et al.
Nature communications, 11(1), 4063-4063 (2020-08-15)
The neuroendocrine hypothalamus is the central regulator of vital physiological homeostasis and behavior. However, the cellular and molecular properties of hypothalamic neural progenitors remain unexplored. Here, hypothalamic radial glial (hRG) and hypothalamic mantle zone radial glial (hmRG) cells are found
Xuyu Qian et al.
Cell stem cell, 26(5), 766-781 (2020-03-07)
Human brain organoids provide unique platforms for modeling development and diseases by recapitulating the architecture of the embryonic brain. However, current organoid methods are limited by interior hypoxia and cell death due to insufficient surface diffusion, preventing generation of architecture
Yangfei Xiang et al.
Molecular cell, 79(1), 84-98 (2020-06-12)
Rett syndrome (RTT), mainly caused by mutations in methyl-CpG binding protein 2 (MeCP2), is one of the most prevalent intellectual disorders without effective therapies. Here, we used 2D and 3D human brain cultures to investigate MeCP2 function. We found that

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica