Pular para o conteúdo
Merck
Todas as fotos(5)

Documentos Principais

HPA045511

Sigma-Aldrich

Anti-MICU2 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-EF-Hand Domain Family, Member A1

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(5)

About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA045511
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunohistochemistry: 1:20- 1:50

sequência de imunogênio

LAAAVAGAALAGAGAAWHHSRVSVAARDGSFTVSAQKNVEHGIIYIGKPSLRKQRFMQFSSLEHEGEYYMTPRDFLFSVMFEQMERKTSVKKLTKKDIEDTLSGIQT

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... EFHA1(221154)

Categorias relacionadas

Descrição geral

MICU2 (mitochondrial calcium uptake 2) belongs to the uniporter complex. It is vigorously expressed in visceral organs. It is usually seen in the mitochondrial intermembrane space. It is located on chromosome 13q11-q12.

Imunogênio

EF-hand domain family, member A1 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-MICU2 has been used in western blotting.

Ações bioquímicas/fisiológicas

MICU2 (mitochondrial calcium uptake 2) plays an important role in the modulation of the mitochondrial calcium uniporter.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST81358

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
A91828
R42335

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

MICU2, a paralog of MICU1, resides within the mitochondrial uniporter complex to regulate calcium handling.
Plovanich M, et al.
PLoS ONE, 8(2):e55785 (2013)
Whole Genome Sequencing identifies homozygous BRCA2 deletion guiding treatment in de-differentiated prostate cancer.
Purshouse K, et al.
Cold Spring Harbor molecular case studies (2017)
Critical reappraisal confirms that Mitofusin 2 is an endoplasmic reticulum?mitochondria tether.
Naon D, et al.
Proceedings of the National Academy of Sciences of the USA, 113(40), 11249-11254 (2016)
Alexander G Bick et al.
Proceedings of the National Academy of Sciences of the United States of America, 114(43), E9096-E9104 (2017-10-27)
Comparative analyses of transcriptional profiles from humans and mice with cardiovascular pathologies revealed consistently elevated expression of
Yangfei Xing et al.
Cell reports, 26(5), 1203-1212 (2019-01-31)
The mitochondrial Ca2+ uniporter complex (MCUC) is responsible for Ca2+ influx into the mitochondrial matrix, playing critical roles in various mitochondrial functions. Eukaryotic MCUC consists of multiple subunits, and its Ca2+ influx activity is controlled by regulatory subunits, including mitochondrial
Exibir todos os documentos relacionados

Global Trade Item Number

SKUGTIN
HPA045511-100UL4061837130663
HPA045511-25UL4061841497660

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica