Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

HPA036528

Sigma-Aldrich

Anti-WAC antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-BM-016, Anti-FLJ31290, Anti-MGC10753, Anti-PRO1741, Anti-WW domain containing adaptor with coiled-coil, Anti-Wwp4

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunohistochemistry: 1:50- 1:200

sequência de imunogênio

RLSDGCHDRRGDSQPYQALKYSSKSHPSSGDHRHEKMRDAGDPSPPNKMLRRSDSPENKYSDSTGHSKAKNVHTHRVRERDGGTSYSPQENSH

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... WAC(51322)

Descrição geral

WAC (WW domain-containing adaptor protein) is present on human chromosome 10p12.1. It has a coiled coil domain and exists in four isoforms.

Imunogênio

WW domain containing adaptor with coiled-coil recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-WAC antibody produced in rabbit can be used for the detection of WAC protein in human embryonic kidney cells 293 lysate by immunoblotting. It may also be used for the detection of WAC proteins in HeLa cells by immunoblotting.

Ações bioquímicas/fisiológicas

WW domain-containing protein associates with Golgi matrix protein 120 and regulates generation of autophagosomes. During amino acid starvation, WAC also interacts with Golgi protein short coiled-coil protein (SCOC) to mediate autophagy. The coiled coil domain of WAC interacts with ubiquitin-protein ligase complex and aids in ubiquitination of histone H2B, favoring gene expression. WAC assists in the activation and entry of polo-like kinase into mitotic cycle. Microdeletions and de novo mutation in the WAC genome locus is associated with behavior disorders, developmental delay and facial abnormalities in children. Nonsense and frameshift mutations in the WAC gene results in a truncated protein product leading to hypotonia, interrupted development and dysmorphic facial features.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST80181

forma física

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

WAC, a functional partner of RNF20/40, regulates histone H2B ubiquitination and gene transcription
Zhang F and Yu X
Molecular Cell, 41(4), 384-397 (2011)
WAC promotes Polo-like kinase 1 activation for timely mitotic entry
Qi F, et al.
Cell Reports, 24(3), 546-556 (2018)
WAC, a novel WW domain-containing adapter with a coiled-coil region, is colocalized with splicing factor SC35
Xu GM and Arnaout MA
Genomics, 79(1), 87-94 (2002)
WAC loss-of-function mutations cause a recognisable syndrome characterised by dysmorphic features, developmental delay and hypotonia and recapitulate 10p11. 23 microdeletion syndrome
DeSanto C, et al.
Journal of medical Genetics, 52(11), 754-761 (2015)
A de novo 10p11. 23-p12. 1 deletion recapitulates the phenotype observed in WAC mutations and strengthens the role of WAC in intellectual disability and behavior disorders
Abdelhedi F, et al.
American Journal of Medical Genetics. Part A, 170(7), 1912-1917 (2016)

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica