HPA021676
Anti-RACK1 antibody produced in rabbit
affinity isolated antibody, buffered aqueous glycerol solution
Sinônimo(s):
Anti-Cell proliferation-inducing gene 21 protein, Anti-Guanine nucleotide-binding protein subunit beta-2-like 1, Anti-Guanine nucleotide-binding protein subunit beta-like protein 12.3, Anti-HLC-7, Anti-RACK1, Anti-Receptor for activated C kinase, Anti-Receptor of activated protein kinase C 1
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Produtos recomendados
fonte biológica
rabbit
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
Formulário
buffered aqueous glycerol solution
reatividade de espécies
mouse, human
técnica(s)
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 0.04-0.4 μg/mL
sequência de imunogênio
CVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDG
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... GNB2L1(10399)
Categorias relacionadas
Descrição geral
Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a stably expressed housekeeping gene localized in alveolar macrophage and neutrophils. The gene has been predicted to encode a protein RACK1 (Receptor for activated C kinase 1). It is mapped on the telomeric position of chromosome 5q35.3.
Imunogênio
Guanine nucleotide-binding protein subunit beta-2-like 1 recombinant protein epitope signature tag (PrEST)
Aplicação
Anti-GNB2L1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Ações bioquímicas/fisiológicas
Guanine nucleotide binding protein (G protein), β polypeptide 2-like 1 (GNB2L1) is a scaffold protein highly involved in the binding and anchorage of protein kinase C. It has been predicted that GNB2L1 may act as a regulatory cofactor of multidrug resistance protein (MDR3/ABCB4) and is vital for the plasma membrane localization and translocation function of ABCB4.
Características e benefícios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligação
Corresponding Antigen APREST74729
forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informações legais
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 1
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Xiaozhu Zhang et al.
BMC molecular biology, 6, 4-4 (2005-02-22)
Reference genes, which are often referred to housekeeping genes, are frequently used to normalize mRNA levels between different samples. However the expression level of these genes may vary among tissues or cells, and may change under certain circumstances. Thus the
Yuki Ikebuchi et al.
Hepatology research : the official journal of the Japan Society of Hepatology, 39(11), 1091-1107 (2009-08-14)
Multidrug resistance protein 3 (MDR3/ABCB4), located on the bile canalicular membrane of hepatocytes, is responsible for the translocation of phosphatidylcholine across the plasma membrane, and its hereditary defect causes liver disorders, such as progressive familial intrahepatic cholestasis type 3. We
Shu Wang et al.
Molecular biology reports, 30(1), 53-60 (2003-04-12)
During a large-scale screen of a human fetal brain cDNA library, a novel human gene GNB2L1 encoding a novel RACK (receptor of activated protein kinase C) protein was isolated and sequenced. The cDNA is 1142 bp long and has a
T Ishii et al.
The European respiratory journal, 27(2), 300-306 (2006-02-03)
The stability of housekeeping genes is critical when performing gene expression studies. To date, there have been no studies that look at the stability of commonly used housekeeping genes in alveolar macrophages. Expression levels may be affected by culture, stimulation
Motoyuki Otsuka et al.
PloS one, 6(9), e24359-e24359 (2011-09-22)
MicroRNAs (miRNAs) are important regulators of gene expression that control physiological and pathological processes. A global reduction in miRNA abundance and function is a general trait of human cancers, playing a causal role in the transformed phenotype. Here, we sought
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica