HPA019827

Anti-NUDT5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-ADP-sugar pyrophosphatase, Anti-Nucleoside diphosphate-linked moiety X motif 5, Anti-Nudix motif 5, Anti-YSA1H
• Número MDL: MFCD04118634
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA019827

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: rat, human
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• sequência de imunogênio: SPAVCMDPGLSNCTIHIVTVTINGDDAENARPKPKPGDGEFVEVISLPKNDLLQRLDALVAEEHLTVDARVYSYALALKHANAKPFEVPFLKF
• nº de adesão UniProt: Q9UKK9
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... NUDT5(11164)

Descrição

Descrição geral

NUDT5 (Nudix, nucleoside diphosphate linked moiety X-type motif 5) is an ADP-ribose pyrophosphatase (ADPRase) consisting of an N-terminal domain with three-stranded antiparallel β-sheet named β1, β2, and β3, the catalytic Nudix domain, and an extended C-terminal α-helix domain. It is a novel member of the Nudix hydrolase superfamily and exists as a homodimer.

Imunogênio

ADP-sugar pyrophosphatase recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Ações bioquímicas/fisiológicas

NUDT5 (Nudix, nucleoside diphosphate linked moiety X-type motif 5) is mainly involved in maintaining the intracellular level of ADP-ribose by hydrolyzing ADP-ribose (ADPR) to AMP and ribose 5′-phosphate. It also restricts non-enzymatic ADP-ribosylation. Its N-terminal antiparallel β-sheet plays an important role in dimerization, which is essential for substrate recognition and enzymatic activity. NUDT5 also has been predicted for altered cell proliferation. It has been suggested that suppressed NUDT5 cell shows delayed cell cycle G1 phase. Thus, it has been concluded that NUDT5 may be involved in cell growth and cell cycle proliferation by regulating G1-S transition in mammalian cells.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST74713

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable