Pular para o conteúdo
Merck
Todas as fotos(6)

Documentos Principais

HPA016952

Sigma-Aldrich

Anti-USP30 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Deubiquitinating enzyme 30, Anti-Ubiquitin carboxyl-terminal hydrolase 30, Anti-Ubiquitin thioesterase 30, Anti-Ubiquitin-specific-processing protease 30

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

Formulário

buffered aqueous glycerol solution

reatividade de espécies

human

validação aprimorada

recombinant expression
Learn more about Antibody Enhanced Validation

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

sequência de imunogênio

IEAKGTLNGEKVEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLGHKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMPFPLPVVPDYSSST

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... USP30(84749)

Descrição geral

USP30 (ubiquitin specific peptidase 30) is a deubiquitinating protein localized in the outer membrane of mitochondria.
USP30 is encoded by the gene mapped to human chromosome 12q24.11. The encoded protein belongs to the ubiquitin-specific protease family.

Imunogênio

Ubiquitin carboxyl-terminal hydrolase 30 recombinant protein epitope signature tag (PrEST)

Aplicação

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-USP30 antibody produced in rabbit has been used in western blotting.

Ações bioquímicas/fisiológicas

USP30 (ubiquitin specific peptidase 30) is involved in the maintenance of mitochondrial morphology through the deubiquitination. It has been reported that USP30 plays an important role in the Parkinson′s disease. Overexpressed USP30 generates damaged mitochondria and blocks parkin′s ability to mediate mitophagy by removing parkin attached ubiquitin. On the other end, reduced activity of USP30 causes enhanced mitochondrial degradation in neurons. Research data has concluded that inhibited expression of USP30 plays a positive role in the Parkinson′s disease by promoting mitochondrial clearance and quality control.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST70812

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Dual role of USP30 in controlling basal pexophagy and mitophagy
Marcassa E, et al.
EMBO Reports, 19(7) (2018)
Yusuke Sato et al.
Nature structural & molecular biology, 24(11), 911-919 (2017-09-26)
Parkin ubiquitin (Ub) ligase (also known as PARK2) ubiquitinates damaged mitochondria for their clearance and quality control. USP30 deubiquitinase opposes parkin-mediated Ub-chain formation on mitochondria by preferentially cleaving Lys6-linked Ub chains. Here, we report the crystal structure of zebrafish USP30
Structural basis for specific cleavage of Lys6-linked polyubiquitin chains by USP30
Sato Y, et al.
Nature Structural and Molecular Biology, 24(11), 911-911 (2017)
Mechanism and regulation of the Lys6-selective deubiquitinase USP30
Gersch M, et al.
Nature Structural and Molecular Biology, 24(11), 920-920 (2017)
A genome-wide study reveals rare CNVs exclusive to extreme phenotypes of Alzheimer disease
Rovelet-Lecrux A, et al.
European Journal of Human Genetics, 20(6), 613-617 (2012)

Global Trade Item Number

SKUGTIN
HPA016952-100UL4061837137785
HPA016952-25UL4061842828999

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica