HPA014670

Anti-ZDHHC5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-DHHC-5, Anti-Palmitoyltransferase ZDHHC5, probable, Anti-Zinc finger DHHC domain-containing protein 5, Anti-Zinc finger protein 375
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA014670
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• sequência de imunogênio: DPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHIVASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPLGRPAVPRFGKPDGLRGRGVGSPE
• nº de adesão UniProt: Q9C0B5
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ZDHHC5(25921)

Descrição

Descrição geral

ZDHHC5 (zinc finger, DHHC-type containing 5) is a member of the family of integral membrane proteins called DHHC (Asp-His-His-Cys). This family has its palmitoyl acyltransferases (PAT) activity conserved through Saccharomyces cerevisiae to mammals. This family has 23 identified members in humans, out of which 17 exhibit PAT activity. ZDHHC5 protein and the mRNA are highly expressed in neurons. It is found in dendrites, in dendritic shafts, and rarely in dendritic spine. ZDHHC5 gene is localized to human chromosome 11. It has the characteristic DHHC domain, and has a highly elongated C-terminal. This C-terminal contains PDZ-binding domain, which is specific for type II PDZ-ligand

Imunogênio

Palmitoyltransferase ZDHHC5, probable recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-ZDHHC5 antibody produced in rabbit has been used in:

• microarray
• immunofluorescence
• immunoprecipitation
• coimmunoprecipitation

Anti-ZDHHC5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

ZDHHC5 (zinc finger, DHHC-type containing 5) is a palmitoyl acyltransferase (PAT), which has its three cysteine residues S-acylated, within the CCX7-13C(S/T) motif. It is responsible for the palmitoylation of somatostatin receptor subtype 5 (SSTR5), which is a GPCR (G-protein coupled receptor). It might also be involved in the palmitoylation of other GPCRs, especially in the brain. This might explain its role in learning, memory and synaptic function. Also this protein is highly expressed in neurons, and might have an essential regulatory role in the neurons. Suppression of ZDHHC5 in mice, shows reduced learning capabilities, and this protein is also linked with neuropsychiatric disorders. This gene locus is also associated with bipolar disorder. It also palmitoylates GRIP1 (Glutamate receptor-interacting protein 1)b protein, and targets it to the endosomes of dendritic cells. This way it controls the trafficking of AMPA-R (α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor).

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST72922

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)