HPA013149

Anti-SPTBN1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Beta-II spectrin, Anti-Fodrin beta chain, Anti-Spectrin beta chain, brain 1, Anti-Spectrin, non-erythroid beta chain 1
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA013149
• NACRES: NA.43

Propriedades

• fonte biológica: rabbit
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• forma: buffered aqueous glycerol solution
• reatividade de espécies: human
• técnica(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• sequência de imunogênio: SLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKE
• nº de adesão UniProt: Q01082
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... SPTBN1(6711)

Descrição

Descrição geral

The gene SPTBN1 (Spectrin β chain, non-erythrocytic 1) is localized to human chromosome 2. Spectrins belong to the superfamily of proteins called F-actin cross linking proteins that function as scaffolding proteins for protein sorting, cell adhesion, and migration. They are also involved in TGF-β signaling.

Imunogênio

Spectrin beta chain, brain 1 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-SPTBN1 antibody produced in rabbit has been used in the study of protein profiling to identify differential abundance in plasma samples of osteoporosis patients when compared to matched healthy controls using the suspension bead array approach.
Anti-SPTBN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

SPTBN1 (Spectrin β chain, non-erythrocytic 1) gene encodes a cytoskeletal protein that interacts with α-synuclein and modulates neurite outgrowth. Its overexpression leads to excessive neurite formation from dopaminergic neuronal cell bodies. SPTBN1 may function as a tumor suppressor and its reduced expression has been correlated with reduced survival of pancreatic cancer patients.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST71563

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)