Pular para o conteúdo
Merck
Todas as fotos(3)

Documentos

HPA000536

Sigma-Aldrich

Anti-SOX11 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinônimo(s):

Anti-Sry (sex determining region y)-box 11

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(3)

About This Item

Número MDL:
MFCD03097284
Código UNSPSC:
12352203
Número do Atlas de Proteínas Humanas:
HPA000536
NACRES:
NA.41

fonte biológica

rabbit

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

linha de produto

Prestige Antibodies® Powered by Atlas Antibodies

forma

buffered aqueous glycerol solution

reatividade de espécies

human

técnica(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

sequência de imunogênio

FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK

nº de adesão UniProt

P35716

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SOX11(6664)

Descrição geral

SOX11 (SRY-box 11) is a transcription factor, that has a high mobility group (HMG) box. It is located on human chromosome 2p25. The protein is expressed in the central and peripheral nervous system, lungs, gastrointestinal tract, pancreas, spleen, kidneys, gonads and the mesenchyme.

Imunogênio

Transcription factor SOX-11 recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-SOX11 antibody produced in rabbit has been used in immunohistochemistry and western blotting.

Ações bioquímicas/fisiológicas

SOX11 (SRY-box 11) plays an important role in the development of the brain. Deletion and de novo mutations of SOX11 results in neurodevelopmental disorders along with characteristics of Coffin−Siris syndrome. The protein also has a role in embryonic and adult neurogenesis, craniofacial osteogenesis, ocular morphogenesis and cardiac growth.

Características e benefícios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST76154

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 1

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Equipamento de proteção individual

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

SOX11 regulates PAX5 expression and blocks terminal B-cell differentiation in aggressive mantle cell lymphoma.
Vegliante MC, et al.
Blood, 28(11), 2012-2012 (2013)
Deletions and de novo mutations of SOX11 are associated with a neurodevelopmental disorder with features of Coffin-Siris syndrome.
Hempel A, et al.
Journal of medical Genetics, 53(3), 152-162 (2016)
Duplication 2p25 in a child with clinical features of CHARGE syndrome.
Sperry ED, et al.
American Journal of Medical Genetics, 170(5), 1148-1154 (2016)
Alejandra Carvajal-Cuenca et al.
Haematologica, 97(2), 270-278 (2011-11-08)
Cyclin D1-positive B cells are occasionally found in the mantle zones of reactive lymphoid follicles, a condition that has been called "in situ mantle cell lymphoma". The clinical significance of this lesion remains uncertain. The clinical and pathological characteristics, including
Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype.
Ribera-Cortada I, et al.
Modern Pathology, 28(11), 1435-1435 (2015)
Exibir todos os documentos relacionados

Artigos

Mesenchymal Stem Cell Markers and Antibodies

Mesenchymal stem cell markers and antibodies suitable for investigating targets in fibroblasts, chondrocytes, adipocytes, osteoblasts, and muscle cells.

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica