Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

AV50519

Sigma-Aldrich

Anti-SPRY3 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-HSPRY3, Anti-Sprouty homolog 3 (Drosophila)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

31 kDa

reatividade de espécies

guinea pig, horse, rabbit, bovine, rat, human, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_005831

nº de adesão UniProt

O43610

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SPRY3(10251)

Imunogênio

Synthetic peptide directed towards the N terminal region of human SPRY3

Aplicação

Anti-SPRY3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Ações bioquímicas/fisiológicas

Sprouty proteins are inhibitors of receptor tyrosine kinase signaling proteins and mediators of organogenesis, branching of lung alveoli and endothelial tubes. They inhibit the activity of Ras/Erk pathway.

Sequência

Synthetic peptide located within the following region: ALSSPSLIVQTHKSDWSLATMPTSLPRSLSQCHQLQPLPQHLSQSSIASS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

G R Guy et al.
The Journal of endocrinology, 203(2), 191-202 (2009-05-09)
Sprouty proteins are involved in organogenesis, particularly during the branching of endothelial tubes, and existing evidence suggests that Sprouty's point of action lies downstream of receptor signaling to inhibit the activation of the central Ras/Erk pathway. How Sprouty proteins accomplish
A A de Maximy et al.
Mechanisms of development, 81(1-2), 213-216 (1999-05-20)
Signaling molecules belonging to the Fibroblast growth factor (Fgf) family are necessary for directing bud outgrowth during tracheal development in Drosophila and lung development in mouse. A potential inhibitor of the Fgf signaling pathway, called Sprouty, has been identified in

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica