AV48268
Anti-PRDX6 (AB1) antibody produced in rabbit
affinity isolated antibody
Sinônimo(s):
Anti-1-Cys, Anti-AOP2, Anti-AiPLA2, Anti-KIAA0106, Anti-MGC46173, Anti-NSGPx, Anti-PRX, Anti-Peroxiredoxin 6
Faça loginpara ver os preços organizacionais e de contrato
About This Item
Código UNSPSC:
12352203
NACRES:
NA.41
Produtos recomendados
fonte biológica
rabbit
Nível de qualidade
conjugado
unconjugated
forma do anticorpo
affinity isolated antibody
tipo de produto de anticorpo
primary antibodies
clone
polyclonal
forma
buffered aqueous solution
peso molecular
25 kDa
reatividade de espécies
horse, bovine, rat, rabbit, dog, human, mouse, guinea pig, sheep
concentração
0.5 mg - 1 mg/mL
técnica(s)
immunohistochemistry: suitable
western blot: suitable
nº de adesão NCBI
nº de adesão UniProt
Condições de expedição
wet ice
temperatura de armazenamento
−20°C
modificação pós-traducional do alvo
unmodified
Informações sobre genes
human ... PRDX6(9588)
Categorias relacionadas
Descrição geral
Peroxiredoxin 6 (PRDX6) is a thiol-specific antioxidant protein that acts as a bifunctional enzyme. It is involved in modulating the susceptibility of beta cells to oxidative stress. Prdx6 deficiency has been linked to impaired homeostasis and cell death/apoptosis. It has also been implicated in papillary thyroid carcinomas.
Rabbit Anti-PRDX6 antibody recognizes pig, bovine, human, mouse, rat, chicken, and zebrafish PRDX6.
Rabbit Anti-PRDX6 antibody recognizes pig, bovine, human, mouse, rat, chicken, and zebrafish PRDX6.
Imunogênio
Synthetic peptide directed towards the C terminal region of human PRDX6
Aplicação
Rabbit Anti-PRDX6 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Ações bioquímicas/fisiológicas
PRDX6 is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. The protein encoded by this gene is a member of the thiol-specific antioxidant protein family. This protein is a bifunctional enzyme with two distinct active sites. It is involved in redox regulation of the cell; it can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. It may play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Sequência
Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP
forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Exoneração de responsabilidade
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Não está encontrando o produto certo?
Experimente o nosso Ferramenta de seleção de produtos.
Código de classe de armazenamento
10 - Combustible liquids
Classe de risco de água (WGK)
WGK 3
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Certificados de análise (COA)
Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Arianna Nicolussi et al.
International journal of oncology, 44(2), 548-556 (2013-12-10)
Many clinical studies highlight the dichotomous role of PRDXs in human cancers, where they can exhibit strong tumor-suppressive or tumor-promoting functions. Recent evidence suggests that lower expression of PRDXs correlates with cancer progression in colorectal cancer (CRC) or in esophageal
Flavia M M Paula et al.
Molecular and cellular endocrinology, 374(1-2), 56-64 (2013-04-30)
Peroxiredoxins are a family of six antioxidant enzymes (PRDX1-6), and may be an alternative system for the pancreatic beta cells to cope with oxidative stress. This study investigated whether the main diabetogenic pro-inflammatory cytokines or the anti-inflammatory cytokine IL-4 modulate
Yanyun Jiang et al.
American journal of translational research, 9(5), 2374-2383 (2017-06-01)
Hyperglycemia-mediated damage to retinal pigment epithelial (RPE) cells plays a central role in the pathogenesis of diabetic retinopathy. Dysregulation of microRNA (miR)-383 modulates pancreatic beta cell survival in diabetes; however, its role in diabetic retinopathy remains unclear. In this study
Nigar Fatma et al.
American journal of physiology. Cell physiology, 301(4), C954-C967 (2011-06-17)
The multifunctional cytoprotective protein peroxiredoxin 6 (Prdx6) maintains cellular homeostasis and membrane integrity by regulating expression of intracellular reactive oxygen species (ROS) and phospholipid turnover. Using cells derived from targeted inactivation of Prdx6 gene or its depletion by RNA interference
C McDonald et al.
International journal of oncology, 45(1), 219-226 (2014-05-03)
Peroxiredoxin (Prdx) proteins are thiol-specific antioxidants that protect cells from oxidative stress in many normal and disease states. There are six Prdx proteins expressed in mammals, each with a characteristic tissue expression, subcellular distribution and substrate specificity. Recent studies have
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica