Pular para o conteúdo
Merck
Todas as fotos(4)

Documentos Principais

AV48205

Sigma-Aldrich

Anti-GOT1 antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-GIG18, Anti-Glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(4)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

46 kDa

reatividade de espécies

horse, human, rabbit, goat, mouse, rat, guinea pig, bovine

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_002070

nº de adesão UniProt

P17174

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... GOT1(2805)

Categorias relacionadas

Descrição geral

Glutamic-oxaloacetic transaminase 1, soluble (GOT1) is an enzyme that is involved in the metabolism of amino acids. It is also involved in tricarboxylic acid and area cycles. Studies have reported that GOT1 plays a role in vesicle formation from the ER. GOT1 has been xenografted to nude mice for radiotherapy studies.
Rabbit Anti-GOT1 antibody recognizes human, mouse, rat, bovine, pig, and chicken GOT1.

Imunogênio

Synthetic peptide directed towards the N terminal region of human GOT1

Aplicação

Rabbit Anti-GOT1 antibody is suitable for western blot applications at a concentration of 5μg/ml.

Ações bioquímicas/fisiológicas

Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Sequência

Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC19370

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Ola Nilsson et al.
Annals of the New York Academy of Sciences, 1014, 275-279 (2004-05-22)
Malignant carcinoid tumors express high numbers of somatostatin receptors. Radiation therapy using labeled somatostatin analogs is a novel treatment modality for these tumors. We have analyzed the biokinetics and therapeutic effect of radiolabeled somatostatin analog on a human midgut carcinoid
Andrés Lorente-Rodríguez et al.
Journal of cell science, 122(Pt 10), 1540-1550 (2009-04-23)
Yip1p belongs to a conserved family of membrane-spanning proteins that are involved in intracellular trafficking. Studies have shown that Yip1p forms a heteromeric integral membrane complex, is required for biogenesis of ER-derived COPII vesicles, and can interact with Rab GTPases.
Tatsunori Suzuki et al.
Cancer gene therapy (2021-04-10)
Mutational activation of the KRAS gene occurs in almost all pancreatic ductal adenocarcinoma (PDAC) and is the earliest molecular event in their carcinogenesis. Evidence has accumulated of the metabolic reprogramming in PDAC, such as amino acid homeostasis and autophagic flux.

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica