Pular para o conteúdo
Merck
Todas as fotos(1)

Documentos Principais

AV46812

Sigma-Aldrich

Anti-RTN4 (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-ASY, Anti-NI220/250, Anti-NOGO, Anti-NOGO-A, Anti-NOGOC, Anti-NSP, Anti-NSP-CL, Anti-Reticulon 4

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

42 kDa

reatividade de espécies

human, rat, horse, mouse, sheep, pig, bovine, rabbit, dog

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... RTN4(57142)

Imunogênio

Synthetic peptide directed towards the middle region of human RTN4

Aplicação

Anti-RTN4 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mLl.

Ações bioquímicas/fisiológicas

RTN4 (reticulon 4) gene is a member of reticulon encoding genes family. It is expressed in oligodendrocytes and predominantly associates with the endoplasmic reticulum. It is a component of CNS white matter that inhibits the axonal regeneration and induces collapse in dorsal root ganglion growth cones. Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease that plays a pivotal role in the generation of amyloid beta-protein (Abeta). RTN4 interacts with BACE1 and blocks its activity.

Sequência

Synthetic peptide located within the following region: FRIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTI

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Kiyoko S Murayama et al.
The European journal of neuroscience, 24(5), 1237-1244 (2006-09-13)
Beta-secretase beta-site APP cleaving enzyme 1 (BACE1), is a membrane-bound aspartyl protease necessary for the generation of amyloid beta-protein (Abeta), which accumulates in the brains of individuals with Alzheimer's disease (AD). To gain insight into the mechanisms by which BACE1
T GrandPré et al.
Nature, 403(6768), 439-444 (2000-02-10)
Adult mammalian axon regeneration is generally successful in the peripheral nervous system (PNS) but is dismally poor in the central nervous system (CNS). However, many classes of CNS axons can extend for long distances in peripheral nerve grafts. A comparison
Min-Eun Park et al.
Vaccine, 32(40), 5221-5227 (2014-07-30)
The immunity and protective capability produced by vaccines can vary remarkably according to the kinds of adjuvants being used. In the case of foot-and-mouth disease (FMD) vaccines in pigs, only oil-adjuvant vaccines have been used, and these tend to show
Xuemei Chen et al.
Experimental neurology, 261, 267-277 (2014-07-30)
Yonkenafil is a novel phosphodiesterase type 5 (PDE5) inhibitor. Here we evaluated the effect of yonkenafil on ischemic injury and its possible mechanism of action. Male Sprague-Dawley rats underwent middle cerebral artery occlusion, followed by intraperitoneal or intravenous treatment with

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica