AV44743

Anti-TGFBR2 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-HNPCC6, Anti-MFS2, Anti-RIIC, Anti-Tbeta, Anti-Transforming growth factor, β receptor II (70/80 kDa)
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 62 kDa
• reatividade de espécies: rabbit, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_001020018
• nº de adesão UniProt: P37173
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... TGFBR2(7048)

Descrição

Descrição geral

Transforming growth factor, β receptor II (70/80 kDa) (TGFBR2, HNPCC6, MFS2, RIIC) is a transmembrane ser/thr protein kinase family receptor for TGF-β (TGFB). TGFBR2 mediate TGF-β cell signaling to regulate/inhibit cell proliferation. Defective TGFBR2 is associated with Marfan syndrome.

Especificidade

Anti-TGFBR2 polyclonal antibody reacts with bovine, rabbit, human, mouse, rat, and pig transforming growth factor, β receptor II proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human TGFBR2

Aplicação

Anti-TGFBR2 polyclonal antibody is used to tag transforming growth factor, β receptor II for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β receptor II in TGF-β signaling and regulation of cell proliferation.

Ações bioquímicas/fisiológicas

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. The protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in its gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.This gene is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It encodes a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein and binds TGF-beta. This receptor/ligand complex phosphorylates proteins which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan Syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Sequência

Synthetic peptide located within the following region: MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSDVEMEAQKDEIICPSCNRT

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable