AV42196

Anti-ITGBL1 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Integrin, β-like 1 (with EGF-like repeat domains), Anti-OSCP, Anti-TIED
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 54 kDa
• reatividade de espécies: horse, pig, dog, human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_004782
• nº de adesão UniProt: O95965
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... ITGBL1(9358)

Descrição

Descrição geral

Integrin, β-like 1 (with EGF-like repeat domains) (ITGBL1, TIED) is a β integrin-related protein found in aorta, thymus and osteogenic sarcoma. Defects in ITGBL1 may be associated with isolated growth hormone deficiency.

Especificidade

Anti-ITGBL1 (AB1) polyclonal antibody reacts with canine, human, bovine, mouse, and rat integrin, β-like 1 (with EGF-like repeat domains) proteins.

Imunogênio

Synthetic peptide directed towards the N terminal region of human ITGBL1

Aplicação

Anti-ITGBL1 (AB1) polyclonal antibody is used to tag integrin, β-like 1 (with EGF-like repeat domains) protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of integrin, β-like 1 (with EGF-like repeat domains) in cell processes such as isolated growth hormone deficiency

Sequência

Synthetic peptide located within the following region: MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable