Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV46329

Sigma-Aldrich

Anti-XTP3TPA (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-CDA03, Anti-MGC5627, Anti-RS21C6, Anti-XTP3-transactivated protein A

Faça loginpara ver os preços organizacionais e de contrato


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

19 kDa

reatividade de espécies

human

concentração

0.5 mg - 1 mg/mL

técnica(s)

immunohistochemistry: suitable
western blot: suitable

nº de adesão NCBI

nº de adesão UniProt

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... XTP3TPA(79077)

Imunogênio

Synthetic peptide directed towards the middle region of human XTP3TPA

Aplicação

Anti-XTP3TPA (AB1) antibody produced in rabbit has been used for western blotting at a concentration of 0.5μg/ml. It has also been used for immunohistochemistry at a concentration of 4-8μg/ml.

Ações bioquímicas/fisiológicas

XTP3TPA (XTP3-transactivated protein A) also referred as DCTPP1 or RS21C6 is a 170 amino acid protein expressed in embryonic and highly proliferating cells primarily in liver, kidney, ovary and testis with particularly high expression in cancer cells.DCTPP1 hydrolyses 5-formyl-dCTP and plays a crucial role in the balance of dCTP as well as facilitates the metabolism of deoxycytidine analogs; hence contribute to the preservation of genome integrity.

Sequência

Synthetic peptide located within the following region: KMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable


Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Cristina E Requena et al.
The Biochemical journal, 459(1), 171-180 (2014-01-29)
The size and composition of dNTP (deoxyribonucleoside triphosphate) pools influence the accuracy of DNA synthesis and consequently the genetic stability of nuclear and mitochondrial genomes. In order to keep the dNTP pool in balance, the synthesis and degradation of DNA
Beili Wu et al.
Journal of molecular biology, 367(5), 1405-1412 (2007-02-27)
RS21-C6, which is highly expressed in all vertebrate genomes and green plants, is proposed to have nucleoside triphosphate pyrophosphohydrolase activity. Here, we report the crystal structures of the core fragment of RS21-C6, named RSCUT, and the complex with the substrate

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica