Pular para o conteúdo
Merck
Todas as fotos(2)

Documentos Principais

AV50589

Sigma-Aldrich

Anti-SIN3B (AB1) antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-KIAA0700, Anti-SIN3 homolog B, transcription Regulator (yeast)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(2)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

Formulário

buffered aqueous solution

peso molecular

133 kDa

reatividade de espécies

mouse, dog, bovine, human, pig

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_056075

nº de adesão UniProt

O75182

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... SIN3B(23309)

Descrição geral

SIN3B codes for SIN3 transcription regulator family member B that interacts with Mad1. It is also known to form a nucleolar complex with leukemia associated ETO homologs.
Rabbit Anti-SIN3B antibody recognizes human, bovine, and mouse SIN3B.

Imunogênio

Synthetic peptide directed towards the middle region of human SIN3B

Aplicação

Rabbit Anti-SIN3B antibody is suitable for western blot applications at a concentration of 1μg/ml.

Ações bioquímicas/fisiológicas

SIN3B acts as a transcriptional repressor. It interacts with MXI1 to repress MYC responsive genes and antagonize MYC oncogenic activities.It also interacts with MAD-MAX heterodimers by binding to MAD. The heterodimer then represses transcription by tethering SIN3B to DNA. SIN3B also forms a complex with FOXK1 which represses transcription.

Sequência

Synthetic peptide located within the following region: NDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILE

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Escolha uma das versões mais recentes:

Certificados de análise (COA)

Lot/Batch Number
QC22721

Não está vendo a versão correta?

Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.

Pesquise por COA

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Rakesh Singh Dhanda et al.
BMC molecular biology, 9, 8-8 (2008-01-22)
SIN3 (SWI-Independent) is part of a transcriptional deacetylase complex, which generally mediates the formation of repressive chromatin. The purpose of this work was to study possible interactions between corepressors human SIN3B (hSIN3B) and the ETO homologues - ETO (eight twenty-one)
C A Spronk et al.
Nature structural biology, 7(12), 1100-1104 (2000-12-02)
Sin3A or Sin3B are components of a corepressor complex that mediates repression by transcription factors such as the helix-loop-helix proteins Mad and Mxi. Members of the Mad/Mxi family of repressors play important roles in the transition between proliferation and differentiation
Ye Zheng et al.
Endocrinology, 155(11), 4507-4520 (2014-07-31)
Endocrine regulation of uterine biology is critical for embryo receptivity and human reproduction. Uterine endometrium depends on extrinsic sex steroid input and hence likely has mechanisms that enable adaptation to hormonal variation. Emerging evidence suggests that sex steroid bioavailability in

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica