Pular para o conteúdo
Merck
Todas as fotos(1)

Key Documents

AV46141

Sigma-Aldrich

Anti-PPIF antibody produced in rabbit

IgG fraction of antiserum

Sinônimo(s):

Anti-CYP3, Anti-Cyp-D, Anti-FLJ90798, Anti-MGC117207, Anti-Peptidylprolyl isomerase F (cyclophilin F)

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(1)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

IgG fraction of antiserum

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

19 kDa

reatividade de espécies

bovine, rat, dog, horse, rabbit, human, guinea pig, mouse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_005720

nº de adesão UniProt

P30405

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... PPIF(10105)

Imunogênio

Synthetic peptide directed towards the middle region of human PPIF

Aplicação

Anti-PPIF antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml.

Ações bioquímicas/fisiológicas

PPIF (peptidylprolyl isomerase F) also referred to as CypD or cyclophilin F belongs to peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases are highly-conserved cytoplasmic enzymes that accelerate protein folding. PPIF is a part of the mitochondrial permeability transition pore (mPTP) in the inner mitochondrial membrane. Hence, it is anticipated that its association with the mPTP masks the binding site for inhibiting inorganic phosphate (Pi) as well as enhances the open possibility of mPTP that results in apoptosis or necrosis.

Sequência

Synthetic peptide located within the following region: GSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLS

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Angelina V Vaseva et al.
Cell, 149(7), 1536-1548 (2012-06-26)
Ischemia-associated oxidative damage leading to necrosis is a major cause of catastrophic tissue loss, and elucidating its signaling mechanism is therefore of paramount importance. p53 is a central stress sensor responding to multiple insults, including oxidative stress to orchestrate apoptotic
Roman A Eliseev et al.
The Journal of biological chemistry, 284(15), 9692-9699 (2009-02-21)
Cyclophilin D (CypD) is a mitochondrial immunophilin and a key positive regulator of the mitochondrial permeability transition (MPT). Several reports have shown that CypD is overexpressed in various tumors, where it has an anti-apoptotic effect. Because the MPT is a
Yuan He et al.
Investigative ophthalmology & visual science, 49(11), 4912-4922 (2008-07-11)
Disruption in intracellular calcium ion (Ca(2+)) homeostasis has major effects on health. Persistent Ca(2+) overload induces mitochondrial permeability transition pore (MPTP) opening, which prompts mitochondrial release of calcium (mCICR) and reactive oxygen species (ROS) into the cytosol which, in turn
Guohua Gong et al.
Journal of molecular and cellular cardiology, 76, 235-246 (2014-09-25)
The heart is an excitable organ that undergoes spontaneous force generation and relaxation cycles driven by excitation-contraction (EC) coupling. A fraction of the oscillating cytosolic Ca(2+) during each heartbeat is taken up by mitochondria to stimulate mitochondrial metabolism, the major

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica