Pular para o conteúdo
Merck
Todas as fotos(5)

Key Documents

AV42623

Sigma-Aldrich

Anti-CHAC1 antibody produced in rabbit

affinity isolated antibody

Sinônimo(s):

Anti-ChaC, cation transport regulator homolog 1 (E. coli), Anti-MGC4504

Faça loginpara ver os preços organizacionais e de contrato
Todas as fotos(5)

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

fonte biológica

rabbit

Nível de qualidade

100

conjugado

unconjugated

forma do anticorpo

affinity isolated antibody

tipo de produto de anticorpo

primary antibodies

clone

polyclonal

forma

buffered aqueous solution

peso molecular

24 kDa

reatividade de espécies

pig, rabbit, human, rat, mouse, dog, bovine, horse

concentração

0.5 mg - 1 mg/mL

técnica(s)

western blot: suitable

nº de adesão NCBI

NP_077016

nº de adesão UniProt

Q9BUX1

Condições de expedição

wet ice

temperatura de armazenamento

−20°C

modificação pós-traducional do alvo

unmodified

Informações sobre genes

human ... CHAC1(79094)

Descrição geral

CHAC1/MGC4504 (cation transport regulator-like protein 1), a novel gene regulated by the atherosclerotic lesion component ox-PAPC (oxidized 1-palmitoyl-2-arachidonyl-sn-3-glycero-phosphorylcholine), is a proapoptotic component of the ATF4-ATF3-CHOP cascade mediating the unfolded protein response pathway within cells.

Especificidade

Anti-CHAC1 polyclonal antibody reacts with human, canine, bovine, rat, mouse, mouse, rat, and human cation transport regulator-like protein 1 proteins.

Imunogênio

Synthetic peptide directed towards the C terminal region of human CHAC1

Aplicação

Anti-CHAC1 polyclonal antibody is used to tag cation transport regulator-like protein 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of CHAC1 in the regulation of apoptosis via the unfolded protein response pathway.

Ações bioquímicas/fisiológicas

CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.

Sequência

Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Não está encontrando o produto certo?  

Experimente o nosso Ferramenta de seleção de produtos.

Código de classe de armazenamento

10 - Combustible liquids

Classe de risco de água (WGK)

WGK 3

Ponto de fulgor (°F)

Not applicable

Ponto de fulgor (°C)

Not applicable

Certificados de análise (COA)

Busque Certificados de análise (COA) digitando o Número do Lote do produto. Os números de lote e remessa podem ser encontrados no rótulo de um produto após a palavra “Lot” ou “Batch”.

Já possui este produto?

Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.

Visite a Biblioteca de Documentos

Nam E Joo et al.
Cancer medicine, 1(3), 295-305 (2013-01-24)
Nisin, a bacteriocin and commonly used food preservative, may serve as a novel potential therapeutic for treating head and neck squamous cell carcinoma (HNSCC), as it induces preferential apoptosis, cell cycle arrest, and reduces cell proliferation in HNSCC cells, compared
Léa Perra et al.
Frontiers in immunology, 9, 2823-2823 (2018-12-18)
In cystic fibrosis (CF), Pseudomonas aeruginosa (Pa) colonizes the lungs, leading to chronic inflammation of the bronchial epithelium. ChaC glutathione-specific γ-glutamylcyclotransferase 1 (CHAC1) mRNA is differentially expressed in primary human airway epithelial cells from bronchi (hAECBs) from patients with CF
Amandeep Kaur et al.
The Journal of biological chemistry, 292(2), 638-651 (2016-12-04)
Glutathione degradation plays an important role in glutathione and redox homeostasis, and thus it is imperative to understand the enzymes and the mechanisms involved in glutathione degradation in detail. We describe here ChaC2, a member of the ChaC family of
Willian Meira et al.
Cancers, 13(6) (2021-04-04)
In our previous study, we showed that a cystine transporter (xCT) plays a pivotal role in ferroptosis of pancreatic ductal adenocarcinoma (PDAC) cells in vitro. However, in vivo xCTKO cells grew normally indicating that a mechanism exists to drastically suppress

Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.

Entre em contato com a assistência técnica