AV40225

Anti-EXOSC10 antibody produced in rabbit

IgG fraction of antiserum

• Sinônimo(s): Anti-Exosome component 10
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: IgG fraction of antiserum
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 97 kDa
• reatividade de espécies: human
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_002676
• nº de adesão UniProt: Q01780
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... EXOSC10(5394)

Descrição

Descrição geral

Exosome complex (RNAse complex), a complex of 3′ -→ 5′ exoribonucleases, is a multi-protein complex that degrades various types of ribonucleic acids (RNA). Exosome component 10 (EXOSC10, PMSCL2, "polymyositis/scleroderma autoantigen 2, 100kDa) is an exoribonuclease that shares sequence similarity to budding yeast Rrp6 and is proposed to catalyze 3′-to-5′ exoribonuclease activity on a variety of nuclear transcripts including ribosomal RNA subunits, RNA that has been poly-adenylated by TRAMP, as well as other nuclear RNA transcripts destined for processing and/or destruction.

Especificidade

Anti-EXOSC10 polyclonal antibody reacts with human, mouse, rat, and bovine polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) proteins.

Imunogênio

Synthetic peptide directed towards the C terminal region of human EXOSC10

Aplicação

Anti-EXOSC10 polyclonal antibody is used to tag polymyositis/scleroderma autoantigen 2, 100kDa for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the possible roles of polymyositis/scleroderma autoantigen 2, 100kDa (Rrp6) in the function of specific exosomes.

Ações bioquímicas/fisiológicas

EXOSC10 contains 1 HRDC domain and 1 3′-5′ exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.

Sequência

Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable