AV38489

Anti-MLLT3 (AB1) antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-AF9, Anti-FLJ2035, Anti-Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 3, Anti-YEATS3
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• forma: buffered aqueous solution
• peso molecular: 63 kDa
• reatividade de espécies: mouse, bovine, human, dog, rabbit
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): western blot: suitable
• nº de adesão NCBI: NP_004520
• nº de adesão UniProt: P42568
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... MLLT3(4300)

Descrição

Imunogênio

Synthetic peptide directed towards the N terminal region of human MLLT3

Ações bioquímicas/fisiológicas

MLLT3 is a regulator of early erythroid and megakaryocytic cell fate in the human system. Expression of MLLT3 in human CD34+ cells induces acute myeloid, lymphoid, or mixed-lineage leukemia in immunodeficient mice. Translocation t (9;11)(p22;q23), a chromosomal aberration involving MLLT3 is associated with acute leukemias.

Sequência

Synthetic peptide located within the following region: MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable